The short version of NAD+ fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2026-01-27 and is reviewed periodically as new material appears.
Nicotinamide mononucleotide, abbreviated NMN, is a naturally occurring nucleotide. Its structure combines a nicotinamide base with a ribose sugar and a phosphate group. Within cells, NMN sits on the biosynthetic route that recycles nicotinamide back into nicotinamide adenine dinucleotide, or NAD+. Because NAD+ participates in redox reactions and signaling, enzymes that produce and consume it influence many metabolic processes. The compound is therefore best described as an intermediate rather than a final signaling molecule.
In the canonical salvage pathway, nicotinamide phosphoribosyltransferase, known as NAMPT, transfers a phosphoribosyl group to nicotinamide and releases NMN. A second enzyme, NMN adenylyltransferase, then attaches an adenylyl group to NMN to form NAD+. Alternative routes exist, including a pathway that uses nicotinamide riboside and its phosphorylated forms. The relative contribution of extracellular NMN to intracellular NAD+ pools remains an area of active investigation, and the roles of specific transporters and enzymes are not completely defined.
NMN is present in small amounts in various foods, including certain vegetables, fruits, and milk, though dietary quantities are generally low. Laboratory research often uses synthetic or enzymatically produced NMN. The compound has drawn interest because NAD+ levels decline with age in some tissues and because restoring NAD+ may affect metabolism in animal models. Whether oral NMN produces meaningful NAD+ increases in humans and whether such changes translate into health benefits are not fully established.
Quantifying NMN requires methods that separate it from structurally similar compounds such as nicotinamide, nicotinamide riboside, and NAD+. Common approaches include high-performance liquid chromatography coupled with ultraviolet detection, liquid chromatography with tandem mass spectrometry, capillary electrophoresis, and nuclear magnetic resonance for identity confirmation. Because NMN is polar and often present at low concentrations in biological samples, sample preparation can involve protein precipitation, solid-phase extraction, or derivatization. Isotope-labeled internal standards help correct for matrix effects and recovery losses. Reported concentrations depend heavily on the matrix, extraction protocol, and analytical platform.
Stability of NMN depends on physical form, temperature, moisture, light, and pH. The solid compound is generally more stable than aqueous solutions, which can degrade over time, especially when warm or exposed to extreme pH. Recommended laboratory storage is typically desiccated at −20 °C or below, protected from light, with containers sealed to limit moisture uptake. In solution, degradation products may include nicotinamide and related ribosides, and the rate varies with buffer composition and concentration. Analytical laboratories often prepare fresh solutions and validate stability for each method.
| Property | Value | Notes |
|---|---|---|
| Chemical name | Nicotinamide mononucleotide | Abbreviated NMN |
| Molecular formula | C11H15N2O8P | Neutral form |
| Molar mass | 334.22 g/mol | Approximate value |
| Appearance | White to off-white powder | Typical solid form |
| Solubility | Water-soluble | May absorb moisture |
Nicotinamide mononucleotide, commonly abbreviated NMN, is a naturally occurring nucleotide. Its structure consists of a nicotinamide ring attached to a ribose sugar that carries a phosphate group. The molecular formula is C11H15N2O8P, and the molar mass is about 334.22 grams per mole. In cells, NMN is an intermediate in the salvage pathway that recycles nicotinamide to maintain NAD+ levels. It is not the same compound as NAD+, although it is a direct precursor in one enzymatic step.
Inside cells, the enzyme nicotinamide phosphoribosyltransferase, or NAMPT, converts nicotinamide and a ribose-phosphate donor into NMN. A second enzyme, NMN adenylyltransferase, then converts NMN into NAD+. NAD+ participates in redox reactions and serves as a substrate for signaling enzymes such as sirtuins, PARPs, and CD38. Because NAD+ levels tend to decline with age in many organisms, NMN has drawn interest as a possible way to influence that decline. Whether oral NMN reliably raises NAD+ in human tissues, and whether any such change modifies disease risk, remain open research questions.
Solid NMN is generally handled as a moisture-sensitive compound. Dry material stored desiccated at low temperature, protected from light, tends to remain stable for extended periods. Aqueous solutions are less stable and can undergo hydrolysis, especially at elevated temperature or alkaline pH. The anomeric form also matters: beta-NMN is the naturally occurring form, while alpha-NMN can appear as a synthetic impurity. Purity and storage conditions therefore influence both analytical results and experimental reproducibility.
Identity and purity are usually assessed with complementary methods. Nuclear magnetic resonance spectroscopy can confirm the molecular structure and distinguish anomeric forms. High-performance liquid chromatography with ultraviolet detection or mass spectrometry is common for assay and related-substance testing. Mass spectrometry also supports trace quantification in biological samples, often with isotope-labeled internal standards. Because NMN lacks a strong chromophore, some ultraviolet methods require careful wavelength selection or derivatization, and laboratories may validate each approach for its intended matrix.
NAD+ serves as a coenzyme in redox reactions and as a substrate for enzymes involved in DNA repair and cellular signaling. In the salvage pathway, nicotinamide is converted to NMN by the enzyme NAMPT. NMN is then converted to NAD+ by NMNAT enzymes. A separate route links nicotinamide riboside to NMN through phosphorylation. These pathways maintain NAD+ levels, which can decline with age or metabolic stress in some tissues. The relative contribution of circulating NMN to tissue NAD+ remains an active area of study.
Research on NMN includes cell studies, animal experiments, and a growing number of human trials. Many early findings come from mice, where changes in NAD+ levels and metabolic markers have been reported. Human data are more limited, and questions remain about effective routes of administration, tissue distribution, and long-term effects. Some trials measure NAD+ in blood or tissue, while others assess physical function or metabolic outcomes. Regulatory status differs between countries, and NMN is not universally approved as a dietary supplement or therapeutic agent.
The citric acid cycle is regulated mainly by the availability of key substrates, particularly the ratio of NAD+ to NADH and the concentrations of calcium, inorganic phosphate, ATP, ADP, and AMP. Citrate – the ion that gives its name to the cycle – is a feedback inhibitor of citrate synthase and also inhibits PFK, providing a direct link between the regulation of the citric acid cycle and glycolysis.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
A lot of effort has been put into controlling cell selectivity. For example, attempts have been made to modify and optimize the physicochemical parameters of the peptides to control the selectivities, including net charge, helicity, hydrophobicity per residue (H), hydrophobic moment (μ) and the angle subtended by the positively charged polar helix face (Φ). Other mechanisms like the introduction of D-amino acids and fluorinated amino acids in the hydrophobic phase are believed to break the secondary structure and thus reduce hydrophobic interaction with mammalian cells. It has also been found that Pro→Nlys substitution in Pro-containing β-turn antimicrobial peptides was a promising strategy for the design of new small bacterial cell-selective antimicrobial peptides with intracellular mechanisms of action. It has been suggested that direct attachment of magainin to the substrate surface decreased nonspecific cell binding and led to improved detection limit for bacterial cells such as Salmonella and E. coli.
Sources: en.wikipedia.org
Chromatin remodelers in the INO80 subfamily are made of multiple subunit complexes with split ATPase domains. The INO80 subfamily's protein domains are an N-terminus, two RuvB-like proteins (Rvb1 and Rvb2), and a C-terminus. The ATPase domain of the N-terminus functions in the identification of DNA damage and aids in the stability of telomeres. A long insertion in the ATPase domain is what recruits the Rvb1 and Rvb2 helicases. These helicases contribute to genome maintenance and are unique to the INO80 subfamily of chromatin remodeling complexes. This subfamily also contains an Arp4-actin complex that aids in stability of genes. The Arp5 subunit is required for ATPase function, binding to the DNA, and relocation of nucleosomes.
The removal of dead cells by neighboring phagocytic cells has been termed efferocytosis. Dying cells that undergo the final stages of apoptosis display apoptotic-cell associated molecular patterns (ACAMPs), such as phosphatidylserine on the outer leaflet of the cell membrane. Phosphatidylserine is normally found on the inner leaflet surface of the plasma membrane, but is redistributed during apoptosis to the extracellular surface by a protein known as scramblase. These molecules mark the cell for phagocytosis by cells possessing the appropriate receptors, such as macrophages. The removal of dying cells by phagocytes occurs in an orderly manner without eliciting an inflammatory response. During apoptosis cellular RNA and DNA are separated from each other and sorted to different apoptotic bodies; separation of RNA is initiated as nucleolar segregation.
Ribosomal RNA (rRNA) is the catalytic component of the ribosomes. The rRNA is the component of the ribosome that hosts translation. Eukaryotic ribosomes contain four different rRNA molecules: 18S, 5.8S, 28S and 5S rRNA. Three of the rRNA molecules are synthesized in the nucleolus, and one is synthesized elsewhere. In the cytoplasm, ribosomal RNA and protein combine to form a nucleoprotein called a ribosome. The ribosome binds mRNA and carries out protein synthesis. Several ribosomes may be attached to a single mRNA at any time. Nearly all the RNA found in a typical eukaryotic cell is rRNA. Transfer-messenger RNA (tmRNA) is found in many bacteria and plastids. It tags proteins encoded by mRNAs that lack stop codons for degradation and prevents the ribosome from stalling.
Sources: en.wikipedia.org
NMN is nicotinamide mononucleotide, a nucleotide intermediate in NAD+ biosynthesis. It occurs naturally in cells and is also produced commercially as a supplement ingredient.
No. NMN is a precursor that can be converted into NAD+, while NAD+ is a dinucleotide coenzyme involved in redox reactions and signaling.
Small amounts have been reported in foods such as edamame, avocado, broccoli, and milk. Dietary amounts are generally much lower than those used in research studies.
Liquid chromatography with tandem mass spectrometry is common because it can quantify low levels of NMN in complex samples. High-performance liquid chromatography with ultraviolet detection is used for simpler purity checks. Nuclear magnetic resonance can confirm identity and detect some impurities.